(data stored in ACNUC7421 zone)

EMBL: CP001115.PE166

CP001115.PE166       Location/Qualifiers
FT   CDS             218908..219390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01253"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47562"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2C3"
FT                   /protein_id="ACO47562.1"
FT                   /translation="MPYMTLSEQVQKLTNPQRSDAFVKAFRTAVREGIIEAAELPQRFT
FT                   LPKEFSRRGQEGTYNRDVKDMAFEVTPEFEEWFERTNMELATNRRGAKVKPTLENIEAG
FT                   LIDFKALAAATREKMEASFSKGQKLGNSRKKTAVVKKSGSGRKSAAGKSAGARNTK"
     MPYMTLSEQV QKLTNPQRSD AFVKAFRTAV REGIIEAAEL PQRFTLPKEF SRRGQEGTYN        60
     RDVKDMAFEV TPEFEEWFER TNMELATNRR GAKVKPTLEN IEAGLIDFKA LAAATREKME       120
     ASFSKGQKLG NSRKKTAVVK KSGSGRKSAA GKSAGARNTK                             160
//

If you have problems or comments...

PBIL Back to PBIL home page