(data stored in ACNUC7421 zone)

EMBL: CP001115.PE167

CP001115.PE167       Location/Qualifiers
FT   CDS             219631..220329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01254"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01254"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47563"
FT                   /db_xref="GOA:C1D2C4"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2C4"
FT                   /protein_id="ACO47563.1"
FT                   /translation="MTPTLRTNPVTAALLDHPFPDGFCQALAATHHWSGLHASLVLTEY
FT                   RRFLALATSGPAAPSRHVMLAHNLHRSVAPDDWQALLELGGESLLTTWDSSGRQVYTST
FT                   LDRYRATFGHPAPANVWHDPRLTPGRTLNNWLMRHARTLISVTLAGVLALLAVNHVLPA
FT                   GVATLLGFILLAAVWEVPGRQGSATARRAVQSYSPYVTVLGAAAAMYGGGPGNGGSDSG
FT                   CGDGGSGGSC"
     MTPTLRTNPV TAALLDHPFP DGFCQALAAT HHWSGLHASL VLTEYRRFLA LATSGPAAPS        60
     RHVMLAHNLH RSVAPDDWQA LLELGGESLL TTWDSSGRQV YTSTLDRYRA TFGHPAPANV       120
     WHDPRLTPGR TLNNWLMRHA RTLISVTLAG VLALLAVNHV LPAGVATLLG FILLAAVWEV       180
     PGRQGSATAR RAVQSYSPYV TVLGAAAAMY GGGPGNGGSD SGCGDGGSGG SC               232
//

If you have problems or comments...

PBIL Back to PBIL home page