(data stored in ACNUC7421 zone)

EMBL: CP001115.PE171

CP001115.PE171       Location/Qualifiers
FT   CDS             complement(226410..226790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01282"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01282"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47568"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2C9"
FT                   /protein_id="ACO47568.1"
FT                   /translation="MSQHSWADNCGAPCFGWSPSQGLRRCGPEELALAWPAGASNLDPE
FT                   DASWRSERRTGQLLHVREGARAGEVAGTVDQAALWWCWWSFARKSVACFSTVTQHHCSL
FT                   LALDFYRSSTPDLPHLRQPLQV"
     MSQHSWADNC GAPCFGWSPS QGLRRCGPEE LALAWPAGAS NLDPEDASWR SERRTGQLLH        60
     VREGARAGEV AGTVDQAALW WCWWSFARKS VACFSTVTQH HCSLLALDFY RSSTPDLPHL       120
     RQPLQV                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page