(data stored in ACNUC7421 zone)

EMBL: CP001115.PE177

CP001115.PE177       Location/Qualifiers
FT   CDS             complement(232292..233641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01310"
FT                   /product="putative 3-carboxy-cis,cis-muconate
FT                   cycloisomerase (3-carboxymuconate lactonizing enzyme)"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01310"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47574"
FT                   /db_xref="GOA:C1D2D5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR012789"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2D5"
FT                   /protein_id="ACO47574.1"
FT                   /translation="MSFTPLDSSLYGSLFTSPAMRQVFSDQQHLQRLVDVEVALAQAQA
FT                   TLGLIPPGAAQDIEAAGRTFQPDLPRLQEGLANDGFPIIALLAQLREHLPEDAAGALHF
FT                   GATTQDILDTALVLQLREALNLMDASLHLLVQLLAHLADQHRRTLMAGRTHSQQALPIS
FT                   FGLKVTGWLAPLLRHQARLGELRPRLLVVQFGGAAGTLAALDQQGPAVAAELARILRLE
FT                   EPLMPWHTQRDTLAELGSWLSLVTGSLGKMAQDIILMAQSEVAEVRESSDPARGGSSTM
FT                   PQKSNPIQSELIVAAARANATLLTGLHQALVQEHERATHGWQLEWLTLPQMLGLTAGAL
FT                   DRAVVLAQELEIDAARMRENVATSQGLMMAEAYVFALTPLLGRKAAKDLVRDAVAVTLA
FT                   GGGALGDSLQTLTDAPIDWNALREDQYLGANDALIDRVLHQVDQPARSHR"
     MSFTPLDSSL YGSLFTSPAM RQVFSDQQHL QRLVDVEVAL AQAQATLGLI PPGAAQDIEA        60
     AGRTFQPDLP RLQEGLANDG FPIIALLAQL REHLPEDAAG ALHFGATTQD ILDTALVLQL       120
     REALNLMDAS LHLLVQLLAH LADQHRRTLM AGRTHSQQAL PISFGLKVTG WLAPLLRHQA       180
     RLGELRPRLL VVQFGGAAGT LAALDQQGPA VAAELARILR LEEPLMPWHT QRDTLAELGS       240
     WLSLVTGSLG KMAQDIILMA QSEVAEVRES SDPARGGSST MPQKSNPIQS ELIVAAARAN       300
     ATLLTGLHQA LVQEHERATH GWQLEWLTLP QMLGLTAGAL DRAVVLAQEL EIDAARMREN       360
     VATSQGLMMA EAYVFALTPL LGRKAAKDLV RDAVAVTLAG GGALGDSLQT LTDAPIDWNA       420
     LREDQYLGAN DALIDRVLHQ VDQPARSHR                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page