(data stored in ACNUC7421 zone)

EMBL: CP001115.PE18

CP001115.PE18        Location/Qualifiers
FT   CDS             27130..27570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00131"
FT                   /product="Hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00131"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47408"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1W9"
FT                   /protein_id="ACO47408.1"
FT                   /translation="MKVLLTATALLGLGVSAAQPTTSGWPQGSCLHGTTINESGRPLNL
FT                   RALEGHIRQLLQQAKVSPAAVCSSYLNILVQAESLSQQNTRITAHLILAEREVSLTDVK
FT                   RNDAVSRCSLTVTDVVHQDEDFFASAQAVLTRVFARAPQCTR"
     MKVLLTATAL LGLGVSAAQP TTSGWPQGSC LHGTTINESG RPLNLRALEG HIRQLLQQAK        60
     VSPAAVCSSY LNILVQAESL SQQNTRITAH LILAEREVSL TDVKRNDAVS RCSLTVTDVV       120
     HQDEDFFASA QAVLTRVFAR APQCTR                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page