(data stored in ACNUC7421 zone)

EMBL: CP001115.PE182

CP001115.PE182       Location/Qualifiers
FT   CDS             236896..237783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01360"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01360"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47579"
FT                   /db_xref="GOA:C1D2E0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2E0"
FT                   /protein_id="ACO47579.1"
FT                   /translation="MNPPADSPQPVRGVLYYIGALLMFAWLDATTKVLTAHYPVPLVAA
FT                   VRYGTQLTLMMALLPRPRRTHLTSTRPGLVAARSVCLVIVTLFMGLALSRLPLAEATSI
FT                   VFIAPLLVALLSGPLLGERLSTGRWLAVIGGFLGVLLIIRPGGQLDVLGVLFALLAALC
FT                   NAAYQLLSRVLNTEKTVNLLYHSALAGAVVFTMIVPFTFGGPPPSLFTALLLLSLGVSG
FT                   GLGHYLFTLAFRDAPASQLAPLTYMQLLWAGVIGLMVFGQLPDAVSLIGMLIIAVSGIS
FT                   VAIRRPGPVLADNS"
     MNPPADSPQP VRGVLYYIGA LLMFAWLDAT TKVLTAHYPV PLVAAVRYGT QLTLMMALLP        60
     RPRRTHLTST RPGLVAARSV CLVIVTLFMG LALSRLPLAE ATSIVFIAPL LVALLSGPLL       120
     GERLSTGRWL AVIGGFLGVL LIIRPGGQLD VLGVLFALLA ALCNAAYQLL SRVLNTEKTV       180
     NLLYHSALAG AVVFTMIVPF TFGGPPPSLF TALLLLSLGV SGGLGHYLFT LAFRDAPASQ       240
     LAPLTYMQLL WAGVIGLMVF GQLPDAVSLI GMLIIAVSGI SVAIRRPGPV LADNS            295
//

If you have problems or comments...

PBIL Back to PBIL home page