(data stored in ACNUC7421 zone)

EMBL: CP001115.PE187

CP001115.PE187       Location/Qualifiers
FT   CDS             complement(244966..245766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01410"
FT                   /product="putative transcriptional regulator, IclR family;
FT                   putative Pca regulon regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01410"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47584"
FT                   /db_xref="GOA:C1D2E5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR012794"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2E5"
FT                   /protein_id="ACO47584.1"
FT                   /translation="MIASPQSADGNRLDDGSGDTIQALVRGLQVIRAFDARHQRMTLTE
FT                   VAGETGLTRATARRCLLTLHQLGYVSWDGKYFGLTPKILTLGYAYLSSTSLPTIVQPAL
FT                   VHLSQQTGASCSACILDSTEAVIVARASPQRFNSTDLGVGSRLPLYCTSLGHVLLAELS
FT                   DEQFEAYLDQTPLVSHTAATLTQAEDVRAAVRLAGTQGFAINAEGLETGLRSISVPLRN
FT                   TLGHVVAAMSATVPVSVASEQEMQDRLLPVLRSQATLLQQMLTA"
     MIASPQSADG NRLDDGSGDT IQALVRGLQV IRAFDARHQR MTLTEVAGET GLTRATARRC        60
     LLTLHQLGYV SWDGKYFGLT PKILTLGYAY LSSTSLPTIV QPALVHLSQQ TGASCSACIL       120
     DSTEAVIVAR ASPQRFNSTD LGVGSRLPLY CTSLGHVLLA ELSDEQFEAY LDQTPLVSHT       180
     AATLTQAEDV RAAVRLAGTQ GFAINAEGLE TGLRSISVPL RNTLGHVVAA MSATVPVSVA       240
     SEQEMQDRLL PVLRSQATLL QQMLTA                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page