(data stored in ACNUC7421 zone)

EMBL: CP001115.PE188

CP001115.PE188       Location/Qualifiers
FT   CDS             245959..246906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01420"
FT                   /product="Conserved hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01420"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47585"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2E6"
FT                   /protein_id="ACO47585.1"
FT                   /translation="MKRTAFTLALSLCCLASAQGYPTKGINFIVPWSPGGSADLTSRTL
FT                   ASAMSKHIGQDVTVVSRTGGGGAIGHLAISQARPTGYDIGMGTLELVIPSWGKQSGLTI
FT                   SNFTPISLVSINPAAITVAKNSPFKTIGDLVTYIKANPGKLKASGTAKGGSWDMARAGF
FT                   LKTIGVKNSALPWVPSQGSAAAIQELLAGGVDVITVSVAEVGNLVKSGEVRTLAVMGDK
FT                   RHADFKNVPTLKESGINWSFGSFLSVVGPRRLSADVVTKLDEAVKAGMQSPEFKKFMDN
FT                   AGFGVNYKNPAQFRVFLNQQAAKMKDVEEFINSN"
     MKRTAFTLAL SLCCLASAQG YPTKGINFIV PWSPGGSADL TSRTLASAMS KHIGQDVTVV        60
     SRTGGGGAIG HLAISQARPT GYDIGMGTLE LVIPSWGKQS GLTISNFTPI SLVSINPAAI       120
     TVAKNSPFKT IGDLVTYIKA NPGKLKASGT AKGGSWDMAR AGFLKTIGVK NSALPWVPSQ       180
     GSAAAIQELL AGGVDVITVS VAEVGNLVKS GEVRTLAVMG DKRHADFKNV PTLKESGINW       240
     SFGSFLSVVG PRRLSADVVT KLDEAVKAGM QSPEFKKFMD NAGFGVNYKN PAQFRVFLNQ       300
     QAAKMKDVEE FINSN                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page