(data stored in ACNUC7421 zone)

EMBL: CP001115.PE189

CP001115.PE189       Location/Qualifiers
FT   CDS             246996..247451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01430"
FT                   /product="Hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01430"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47586"
FT                   /db_xref="GOA:C1D2E7"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2E7"
FT                   /protein_id="ACO47586.1"
FT                   /translation="MEQQEHPAWELGLSLFLIVCGIATWILSASFPQLEDGAPGPALFP
FT                   RLIGAGMILGGAVLSISALKDLRSAHGSLPFLDSRLGLLKVFAAVGIAAMVPLLMPYIT
FT                   LVGGIALAAALFALLIGTDLPRSIGVGLFTALVVYGVFGKLLGVPLS"
     MEQQEHPAWE LGLSLFLIVC GIATWILSAS FPQLEDGAPG PALFPRLIGA GMILGGAVLS        60
     ISALKDLRSA HGSLPFLDSR LGLLKVFAAV GIAAMVPLLM PYITLVGGIA LAAALFALLI       120
     GTDLPRSIGV GLFTALVVYG VFGKLLGVPL S                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page