(data stored in ACNUC7421 zone)

EMBL: CP001115.PE190

CP001115.PE190       Location/Qualifiers
FT   CDS             247448..248995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01440"
FT                   /product="Conserved hypothetical protein, precursor;
FT                   putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01440"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47587"
FT                   /db_xref="GOA:C1D2E8"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2E8"
FT                   /protein_id="ACO47587.1"
FT                   /translation="MNNLLSWESFLALILGSLFGAVFGSIPGLTATLALSLFVPLALFL
FT                   DPSLVLPAVIGISTAAIFAGDIGSITVKIPGTAASAAYSDEINRMGKGSIAYAMGVATL
FT                   PSAVGAMVGVVILMIGAGLLAQFAKQFSSFEYFWLAVLGLVAGIFATQGKLIKGALSLG
FT                   IGVLISTVGLDPTLGYARFSFGSPNMLAGINYVVALIGLFGISELLEQAYKGVLKTEAV
FT                   VSTDDMRAQRRKVQHDYWVRPSLLMLRERGAMMRASLVGTGVGFLPGAGSDLAAWLSSS
FT                   LERMRTRKAQMTSAEVTRQEETVVLAGTASNNAAVAGAWIPAMALGIPGDTLTAIVLGV
FT                   FLIAGITPGPQLFTENRGLVNQIYLAFAVASVVIMPIMGLLAAYGAGYITRIPFRLLMG
FT                   FILGLTVIGAYAINNNPFDIWVMLALGAFGFVLKRGGFPLAQVVLGMVLGPLLEQNFMV
FT                   SVIKVHWNFASFFERPVALILMLATLLIIVFGSRMNHLYQKSIQAPAAGTDVPTGSV"
     MNNLLSWESF LALILGSLFG AVFGSIPGLT ATLALSLFVP LALFLDPSLV LPAVIGISTA        60
     AIFAGDIGSI TVKIPGTAAS AAYSDEINRM GKGSIAYAMG VATLPSAVGA MVGVVILMIG       120
     AGLLAQFAKQ FSSFEYFWLA VLGLVAGIFA TQGKLIKGAL SLGIGVLIST VGLDPTLGYA       180
     RFSFGSPNML AGINYVVALI GLFGISELLE QAYKGVLKTE AVVSTDDMRA QRRKVQHDYW       240
     VRPSLLMLRE RGAMMRASLV GTGVGFLPGA GSDLAAWLSS SLERMRTRKA QMTSAEVTRQ       300
     EETVVLAGTA SNNAAVAGAW IPAMALGIPG DTLTAIVLGV FLIAGITPGP QLFTENRGLV       360
     NQIYLAFAVA SVVIMPIMGL LAAYGAGYIT RIPFRLLMGF ILGLTVIGAY AINNNPFDIW       420
     VMLALGAFGF VLKRGGFPLA QVVLGMVLGP LLEQNFMVSV IKVHWNFASF FERPVALILM       480
     LATLLIIVFG SRMNHLYQKS IQAPAAGTDV PTGSV                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page