(data stored in ACNUC7421 zone)

EMBL: CP001115.PE198

CP001115.PE198       Location/Qualifiers
FT   CDS             257501..258253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01520"
FT                   /product="Conserved hypothetical protein, precursor;
FT                   putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01520"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47595"
FT                   /db_xref="GOA:C1D2F6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2F6"
FT                   /protein_id="ACO47595.1"
FT                   /translation="MILLSTLLIGLLAGVLGAILGLGGGVVVVPAMEFLLPRLGHPLTI
FT                   GQAVAISQFSVLAVGLAGAASYLQQGLVRARTGYLLSPYTIVGGALGSFLGLVLPARAV
FT                   ATVFAMLLLYSAYTLVRGLKRVEVEREPSRLVPPAMTFAGVMSGLLGIGGGTVQVPVMN
FT                   LLGGLPIRQAIATSTFIMGLTAVGNALIYQAGGLLNAQLACAIAFGVLIGARAGAGLQK
FT                   RIPDRELKIFFAGLVTLTAVQLLYKYWS"
     MILLSTLLIG LLAGVLGAIL GLGGGVVVVP AMEFLLPRLG HPLTIGQAVA ISQFSVLAVG        60
     LAGAASYLQQ GLVRARTGYL LSPYTIVGGA LGSFLGLVLP ARAVATVFAM LLLYSAYTLV       120
     RGLKRVEVER EPSRLVPPAM TFAGVMSGLL GIGGGTVQVP VMNLLGGLPI RQAIATSTFI       180
     MGLTAVGNAL IYQAGGLLNA QLACAIAFGV LIGARAGAGL QKRIPDRELK IFFAGLVTLT       240
     AVQLLYKYWS                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page