(data stored in ACNUC7421 zone)

EMBL: CP001115.PE199

CP001115.PE199       Location/Qualifiers
FT   CDS             258256..258528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01530"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01530"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47596"
FT                   /db_xref="GOA:C1D2F7"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2F7"
FT                   /protein_id="ACO47596.1"
FT                   /translation="MKLPTTTTEAGVLSGWVFPWGFRLALPVLLASMLWPQAADAGLWF
FT                   MMGLPAFAAMTVVHRNWSTDRTVSLAALTALGGVLAVVVLKSLLL"
     MKLPTTTTEA GVLSGWVFPW GFRLALPVLL ASMLWPQAAD AGLWFMMGLP AFAAMTVVHR        60
     NWSTDRTVSL AALTALGGVL AVVVLKSLLL                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page