(data stored in ACNUC7421 zone)

EMBL: CP001115.PE200

CP001115.PE200       Location/Qualifiers
FT   CDS             258576..259523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01540"
FT                   /product="putative acetamidase/formamidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01540"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47597"
FT                   /db_xref="GOA:C1D2F8"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2F8"
FT                   /protein_id="ACO47597.1"
FT                   /translation="MTIIPVPAERLIYAMDRSNAPLVTVPDGSVLTFETRDCFEDQIQD
FT                   AGADFVTLDWTRVNPATGPVFVEGAQPGDALAVEIQHIEIGSQAVMVTGPGLGVEGDVL
FT                   EHPTVRVYPINDGHITMGAVKIPVQPMIGVIGTAPAGDPVPNGTPGPHGGNMDTRLIQA
FT                   GTTLLLPVEVEGGLLAMGDLHAAMGDGEVSVCGLEVPGRVTVRVRVVPQCRWPLPMLHT
FT                   DTHVYTIASAVTLDEAAVMATKQMSAFVQAGTGLSPADAIGLLSAAGNLQISQVVDPLK
FT                   TCRFELSLDILSALGFTPERDIRLAATAGQPAAD"
     MTIIPVPAER LIYAMDRSNA PLVTVPDGSV LTFETRDCFE DQIQDAGADF VTLDWTRVNP        60
     ATGPVFVEGA QPGDALAVEI QHIEIGSQAV MVTGPGLGVE GDVLEHPTVR VYPINDGHIT       120
     MGAVKIPVQP MIGVIGTAPA GDPVPNGTPG PHGGNMDTRL IQAGTTLLLP VEVEGGLLAM       180
     GDLHAAMGDG EVSVCGLEVP GRVTVRVRVV PQCRWPLPML HTDTHVYTIA SAVTLDEAAV       240
     MATKQMSAFV QAGTGLSPAD AIGLLSAAGN LQISQVVDPL KTCRFELSLD ILSALGFTPE       300
     RDIRLAATAG QPAAD                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page