(data stored in ACNUC7421 zone)

EMBL: CP001115.PE205

CP001115.PE205       Location/Qualifiers
FT   CDS             267525..267944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01581"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01581"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47603"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2G4"
FT                   /protein_id="ACO47603.2"
FT                   /translation="MPRLTPDETTAVLKRHQQMRGGVLRLARLRYETALHPPTPDLVVQ
FT                   LDAPDLDSSSGWCRMSLTLEGVATLWLREDEATNMVLLGGLAIVYAGDRVYVDFSPPAV
FT                   DGYDLTDFSTSTFSVSAKALWVQVSPLDAAVPDPA"
     MPRLTPDETT AVLKRHQQMR GGVLRLARLR YETALHPPTP DLVVQLDAPD LDSSSGWCRM        60
     SLTLEGVATL WLREDEATNM VLLGGLAIVY AGDRVYVDFS PPAVDGYDLT DFSTSTFSVS       120
     AKALWVQVSP LDAAVPDPA                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page