(data stored in ACNUC7421 zone)

EMBL: CP001115.PE206

CP001115.PE206       Location/Qualifiers
FT   CDS             268868..269605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01582"
FT                   /product="putative aquaporin (major intrinsic protein),
FT                   precursor; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01582"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47604"
FT                   /db_xref="GOA:C1D2G5"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR023743"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2G5"
FT                   /protein_id="ACO47604.1"
FT                   /translation="MTRMSRLVAEFIGTFWLVFGGAGSAVFAAAFPEVGIGLLGVSLAF
FT                   GLAVMTMAYSVGHISGSHFNPAVTLGVWAGGRFPARDVLPYILAQVAGGILAALLLYGI
FT                   ARGTPSFDLATDGLAANGYGQHSPGRYSLMAGFVVELVLTFMFLIIIMGATHRKAPAGF
FT                   APIAIGLALTLIHLISIPITNTSVNPARSTGPALIVGGWAVQQLWMFWLAPLLGGLLGG
FT                   MAYRSMFKDDSAPDITGETQPVT"
     MTRMSRLVAE FIGTFWLVFG GAGSAVFAAA FPEVGIGLLG VSLAFGLAVM TMAYSVGHIS        60
     GSHFNPAVTL GVWAGGRFPA RDVLPYILAQ VAGGILAALL LYGIARGTPS FDLATDGLAA       120
     NGYGQHSPGR YSLMAGFVVE LVLTFMFLII IMGATHRKAP AGFAPIAIGL ALTLIHLISI       180
     PITNTSVNPA RSTGPALIVG GWAVQQLWMF WLAPLLGGLL GGMAYRSMFK DDSAPDITGE       240
     TQPVT                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page