(data stored in ACNUC7421 zone)

EMBL: CP001115.PE209

CP001115.PE209       Location/Qualifiers
FT   CDS             complement(272491..273546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01585"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01585"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47607"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2G8"
FT                   /protein_id="ACO47607.1"
FT                   /translation="MELLEIRLGLADAPGPSHGSEQRSARPGSSRAQASPGRGQPAAGG
FT                   QKHGTSASTVDFEVLLFQHLSGAERRRLLHGPRFSQGLFQAVRGTSAYSRLLAEAHALD
FT                   VSNIGVRLGDQTLMQWLDRILSRQGSRVKCRAAAQTIYDDLVSYCRLEYVTYTREDRQA
FT                   TQRDQSQEEARRVGEARRQAAEARRDRERRAQSRRRKAEEARHARGGESASQQSAGTRT
FT                   SSQEPFGTADQSRRPSATTQESVVFFREFHHLAEARLYLRVARLQVGLQGHVRSFSRNR
FT                   VFVVELVVPSTLKEAVDLSYQRALSALQGAAERIRAEAAAARDEAIRQAEAAYAEQYEQ
FT                   AFEIAVERYTS"
     MELLEIRLGL ADAPGPSHGS EQRSARPGSS RAQASPGRGQ PAAGGQKHGT SASTVDFEVL        60
     LFQHLSGAER RRLLHGPRFS QGLFQAVRGT SAYSRLLAEA HALDVSNIGV RLGDQTLMQW       120
     LDRILSRQGS RVKCRAAAQT IYDDLVSYCR LEYVTYTRED RQATQRDQSQ EEARRVGEAR       180
     RQAAEARRDR ERRAQSRRRK AEEARHARGG ESASQQSAGT RTSSQEPFGT ADQSRRPSAT       240
     TQESVVFFRE FHHLAEARLY LRVARLQVGL QGHVRSFSRN RVFVVELVVP STLKEAVDLS       300
     YQRALSALQG AAERIRAEAA AARDEAIRQA EAAYAEQYEQ AFEIAVERYT S                351
//

If you have problems or comments...

PBIL Back to PBIL home page