(data stored in ACNUC7421 zone)

EMBL: CP001115.PE210

CP001115.PE210       Location/Qualifiers
FT   CDS             273649..273957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01586"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01586"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47608"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2G9"
FT                   /protein_id="ACO47608.1"
FT                   /translation="MRGRDTLPVNLDGLVDRPLAICPAPRTAILCLRSRHFVFWAPTPQ
FT                   PEQPSHNRTVQCGRPGPAPELCRSAGPMRETAVPSGDILPHWNVRHQRKEVCSRRLL"
     MRGRDTLPVN LDGLVDRPLA ICPAPRTAIL CLRSRHFVFW APTPQPEQPS HNRTVQCGRP        60
     GPAPELCRSA GPMRETAVPS GDILPHWNVR HQRKEVCSRR LL                          102
//

If you have problems or comments...

PBIL Back to PBIL home page