(data stored in ACNUC7421 zone)

EMBL: CP001115.PE215

CP001115.PE215       Location/Qualifiers
FT   CDS             278735..280192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01630"
FT                   /product="putative carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01630"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47613"
FT                   /db_xref="GOA:C1D2H4"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2H4"
FT                   /protein_id="ACO47613.1"
FT                   /translation="MRAVHAPPPVVLALDLGSSSVKGAAFDIHGRVLAGLEAHENVSLH
FT                   YAAGGAAEVPLADLVAAAEAVLDRLHGRLGSRSVLAVAMTSIASSLVALDARGEPVGPV
FT                   LSYADTRSAGEVRAVETLTSREETGCPAFSAYWPAQVRWWQGAHPELPAEHFCSVPDFL
FT                   LMRWTGELVTSYSLASWTGLLDRETLDWNMRALSTAGLSAAQLPRLGDHDTRLTLQSRW
FT                   TDRWPKLAGVPFHPGVADGATANVGSGALTPGRPAITIGSTSAVRLAVQGAPPPIPSGL
FT                   WSYRIDRNTHLLGGALTEGGNLYSWLQSTLRLDRRLDEELLGMAPGAHGLTFVPSLGGT
FT                   RSPDYDPHARGTLHGLSYATTPAQITRAAMEGVACRLANVAWRLPVSDDALFVASGRAL
FT                   LASRAWPQMLADALGRPLLLEDIRAGASARGAALLALRAQGVEISTDPVAQRVVEPVPA
FT                   HHEVYRTMCARMDRLTRLMREDEELVS"
     MRAVHAPPPV VLALDLGSSS VKGAAFDIHG RVLAGLEAHE NVSLHYAAGG AAEVPLADLV        60
     AAAEAVLDRL HGRLGSRSVL AVAMTSIASS LVALDARGEP VGPVLSYADT RSAGEVRAVE       120
     TLTSREETGC PAFSAYWPAQ VRWWQGAHPE LPAEHFCSVP DFLLMRWTGE LVTSYSLASW       180
     TGLLDRETLD WNMRALSTAG LSAAQLPRLG DHDTRLTLQS RWTDRWPKLA GVPFHPGVAD       240
     GATANVGSGA LTPGRPAITI GSTSAVRLAV QGAPPPIPSG LWSYRIDRNT HLLGGALTEG       300
     GNLYSWLQST LRLDRRLDEE LLGMAPGAHG LTFVPSLGGT RSPDYDPHAR GTLHGLSYAT       360
     TPAQITRAAM EGVACRLANV AWRLPVSDDA LFVASGRALL ASRAWPQMLA DALGRPLLLE       420
     DIRAGASARG AALLALRAQG VEISTDPVAQ RVVEPVPAHH EVYRTMCARM DRLTRLMRED       480
     EELVS                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page