(data stored in ACNUC7421 zone)

EMBL: CP001115.PE217

CP001115.PE217       Location/Qualifiers
FT   CDS             280809..281747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01650"
FT                   /product="putative 2-keto-3-deoxygluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01650"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47615"
FT                   /db_xref="GOA:C1D2H6"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2H6"
FT                   /protein_id="ACO47615.1"
FT                   /translation="MSEGGVLTFGEALLKLALPQAHRIEDMRAIRAECGGSELNVAAAL
FT                   RALGRPAAWISALPDGPLGDWARAQVRMLGVQDFSVERSGRLGSFYLEDHHPPRPSRVI
FT                   YDRQGTAFQALTAADLSPSWLTGQVAFHVSGISLALGPGPQELALALVTAARERKVLVS
FT                   FDVNHRRKLLPDAAAVQTYGPAARHADVIFVAQRDAGLLGGVSDLRALNPRALLVVTCG
FT                   AQGSQAHLPGGEIVHQPAFAAAGPGRVGRGDAFAGGFLHAWLGQATPAQALQFASACAA
FT                   LKTTLPGDQLHVSDGDLKAVLAGSESGEPLR"
     MSEGGVLTFG EALLKLALPQ AHRIEDMRAI RAECGGSELN VAAALRALGR PAAWISALPD        60
     GPLGDWARAQ VRMLGVQDFS VERSGRLGSF YLEDHHPPRP SRVIYDRQGT AFQALTAADL       120
     SPSWLTGQVA FHVSGISLAL GPGPQELALA LVTAARERKV LVSFDVNHRR KLLPDAAAVQ       180
     TYGPAARHAD VIFVAQRDAG LLGGVSDLRA LNPRALLVVT CGAQGSQAHL PGGEIVHQPA       240
     FAAAGPGRVG RGDAFAGGFL HAWLGQATPA QALQFASACA ALKTTLPGDQ LHVSDGDLKA       300
     VLAGSESGEP LR                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page