(data stored in ACNUC7421 zone)

EMBL: CP001115.PE221

CP001115.PE221       Location/Qualifiers
FT   CDS             complement(284874..285305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01690"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47619"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2I0"
FT                   /protein_id="ACO47619.1"
FT                   /translation="MTKLTVGPWIAAQKLPNRDVARDRQAFLERVRTRDETPSVAGFPL
FT                   VGLGGSCGKPCFALPYVLSWTDENTRRLEEVADRYDCYVEYGVYPHLKLRENDQEVGAV
FT                   QDWTTFAMVYLRPGYERAQELLVDLAETLRPQEMTTNPK"
     MTKLTVGPWI AAQKLPNRDV ARDRQAFLER VRTRDETPSV AGFPLVGLGG SCGKPCFALP        60
     YVLSWTDENT RRLEEVADRY DCYVEYGVYP HLKLRENDQE VGAVQDWTTF AMVYLRPGYE       120
     RAQELLVDLA ETLRPQEMTT NPK                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page