(data stored in ACNUC7421 zone)

EMBL: CP001115.PE222

CP001115.PE222       Location/Qualifiers
FT   CDS             complement(285352..287859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01700"
FT                   /product="putative copper-exporting ATPase; putative
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01700"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47620"
FT                   /db_xref="GOA:C1D2I1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2I1"
FT                   /protein_id="ACO47620.1"
FT                   /translation="MTKTVELGVQGMTCASCVGRVERGLSKVEGVDQATVNLATERATV
FT                   SYDPEKTSPQALMDKVRAIGYEPVVGTLELGVQGMTCANCVGRVERTLKKVDGVLEANV
FT                   NLATERASIRYLPASVSPGQLKAAVRASGYEILENEAGKDRTDQEREVREREVQGLRRA
FT                   VIFSAVFAVPLLLLAMVPMLYMPFHMWLTGYVDMGTLNWIMLALAAPVQFGPGLRFYRL
FT                   GWKSLTHRSPDMNSLVMIGTSAAFFYSLLVTVAPQIFPEGTAHVYYEASAVVITLILLG
FT                   KYFEAIAKGRSSEAMKKLLSLQPKTARVVRQGQEHEVPTDEVLIGDLLAVRPGEKIPVD
FT                   GEVTGGNSFVDESMITGEPVPVNKQAGSSVVGGTINQNGALTFKATRVGADTALAQIIK
FT                   LVETAQGSKPPIQGLADKVVSVFVPVVLGIAALTFVLWMIFGGQTALSFALVNTVAVLI
FT                   IACPCAMGLATPTSIMVGTGKAAELGVLFRNGSALEGLQGVQVVAVDKTGTLTRGRPEL
FT                   TDLVTTPAFDRQQVLGLVAAAEAQSEHPIAQAIVEAARREGITPLTTDHFEAVPGFGLE
FT                   ARVAGHLVQIGADRYMTRLGLDTGAFTAQAHQLGDEGKSPMYAAIDGQLAAIIAVADPI
FT                   KEGSFEAVRALHRQGLKVAMITGDNGRTAHAIARQLGIDEVLAEVLPSGKSDAVKALQA
FT                   QGHKVAFVGDGINDAPALAQADVGLAIGTGTDVAVETADVILMSGDLRGVPNAYALSRA
FT                   TLRNIRLNLFWAFAYNVILIPVAAGVLYPTFGWLLSPVLAAAAMGFSSVFVLTNALRLR
FT                   GFRPPVRPDHVPAHTPASSPLHA"
     MTKTVELGVQ GMTCASCVGR VERGLSKVEG VDQATVNLAT ERATVSYDPE KTSPQALMDK        60
     VRAIGYEPVV GTLELGVQGM TCANCVGRVE RTLKKVDGVL EANVNLATER ASIRYLPASV       120
     SPGQLKAAVR ASGYEILENE AGKDRTDQER EVREREVQGL RRAVIFSAVF AVPLLLLAMV       180
     PMLYMPFHMW LTGYVDMGTL NWIMLALAAP VQFGPGLRFY RLGWKSLTHR SPDMNSLVMI       240
     GTSAAFFYSL LVTVAPQIFP EGTAHVYYEA SAVVITLILL GKYFEAIAKG RSSEAMKKLL       300
     SLQPKTARVV RQGQEHEVPT DEVLIGDLLA VRPGEKIPVD GEVTGGNSFV DESMITGEPV       360
     PVNKQAGSSV VGGTINQNGA LTFKATRVGA DTALAQIIKL VETAQGSKPP IQGLADKVVS       420
     VFVPVVLGIA ALTFVLWMIF GGQTALSFAL VNTVAVLIIA CPCAMGLATP TSIMVGTGKA       480
     AELGVLFRNG SALEGLQGVQ VVAVDKTGTL TRGRPELTDL VTTPAFDRQQ VLGLVAAAEA       540
     QSEHPIAQAI VEAARREGIT PLTTDHFEAV PGFGLEARVA GHLVQIGADR YMTRLGLDTG       600
     AFTAQAHQLG DEGKSPMYAA IDGQLAAIIA VADPIKEGSF EAVRALHRQG LKVAMITGDN       660
     GRTAHAIARQ LGIDEVLAEV LPSGKSDAVK ALQAQGHKVA FVGDGINDAP ALAQADVGLA       720
     IGTGTDVAVE TADVILMSGD LRGVPNAYAL SRATLRNIRL NLFWAFAYNV ILIPVAAGVL       780
     YPTFGWLLSP VLAAAAMGFS SVFVLTNALR LRGFRPPVRP DHVPAHTPAS SPLHA            835
//

If you have problems or comments...

PBIL Back to PBIL home page