(data stored in ACNUC7421 zone)

EMBL: CP001115.PE223

CP001115.PE223       Location/Qualifiers
FT   CDS             288002..288205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01705"
FT                   /product="putative heavy-metal-associated domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01705"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47621"
FT                   /db_xref="GOA:C1D2I2"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2I2"
FT                   /protein_id="ACO47621.1"
FT                   /translation="MTTELIVSGMTCGHCETAVKNALKDVPGVQDVRVDLKGGTAAVEG
FT                   DVDAQALIAAVTEEGYGAQVCQ"
     MTTELIVSGM TCGHCETAVK NALKDVPGVQ DVRVDLKGGT AAVEGDVDAQ ALIAAVTEEG        60
     YGAQVCQ                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page