(data stored in ACNUC7421 zone)

EMBL: CP001115.PE224

CP001115.PE224       Location/Qualifiers
FT   CDS             288207..288530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01710"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47622"
FT                   /db_xref="GOA:C1D2I3"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2I3"
FT                   /protein_id="ACO47622.1"
FT                   /translation="MTAAKDKTAACHTPAAGHLCMPEDSRKRAARRLKIARGHLDSIVT
FT                   MLEKDDAYCVDVLRQLKAVQGALSGAGEVVLRGHLEAHVATASTRGDSVEIVEELMEAL
FT                   KYT"
     MTAAKDKTAA CHTPAAGHLC MPEDSRKRAA RRLKIARGHL DSIVTMLEKD DAYCVDVLRQ        60
     LKAVQGALSG AGEVVLRGHL EAHVATASTR GDSVEIVEEL MEALKYT                     107
//

If you have problems or comments...

PBIL Back to PBIL home page