(data stored in ACNUC7421 zone)

EMBL: CP001115.PE226

CP001115.PE226       Location/Qualifiers
FT   CDS             complement(290865..292259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01730"
FT                   /product="putative chromate transport; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01730"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47625"
FT                   /db_xref="GOA:C1D2I6"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2I6"
FT                   /protein_id="ACO47625.1"
FT                   /translation="MTQLPDRPVLHPREVSFQEATAAWARIAAQSFGGPAGQIAVMHRI
FT                   LVEEKRWISEERFLHALNYCMLLPGPEAQQLAIYIGWLLNGTKGGIVAGCLFVLPGFIS
FT                   ILILSIIYALYQETTLVQAVFFGLKAAVLVIVLDAVLRIGKRALKHPLLVVLAGVAFVS
FT                   IFFFNVPFPLVVLGAGLIGYFGSRVRPEVFQGNGGHGSSAHGEEVRDAVITAETATRVT
FT                   PSWNRFFRITAIGLATWFGPLLLVGALFGFSSVFWLMAKFFSQMAVVTFGGAYAVLAYV
FT                   AQEAVQVFGWLKPGEMLNGLGMAETTPGPLIQVVQYVGFMGAFRDPEGLTPLAAGILAS
FT                   VVVTWATYAPCFLWIFLGAPYIEQLRGNKALSGALTAITAAVVGVILNLSVWFALNTLF
FT                   SRVGETHLGPLRLYTPDWSTLNIPSLVLAVIAGIALFRFKLGAIPTLALTTVLGAAFVL
FT                   LTRSGG"
     MTQLPDRPVL HPREVSFQEA TAAWARIAAQ SFGGPAGQIA VMHRILVEEK RWISEERFLH        60
     ALNYCMLLPG PEAQQLAIYI GWLLNGTKGG IVAGCLFVLP GFISILILSI IYALYQETTL       120
     VQAVFFGLKA AVLVIVLDAV LRIGKRALKH PLLVVLAGVA FVSIFFFNVP FPLVVLGAGL       180
     IGYFGSRVRP EVFQGNGGHG SSAHGEEVRD AVITAETATR VTPSWNRFFR ITAIGLATWF       240
     GPLLLVGALF GFSSVFWLMA KFFSQMAVVT FGGAYAVLAY VAQEAVQVFG WLKPGEMLNG       300
     LGMAETTPGP LIQVVQYVGF MGAFRDPEGL TPLAAGILAS VVVTWATYAP CFLWIFLGAP       360
     YIEQLRGNKA LSGALTAITA AVVGVILNLS VWFALNTLFS RVGETHLGPL RLYTPDWSTL       420
     NIPSLVLAVI AGIALFRFKL GAIPTLALTT VLGAAFVLLT RSGG                        464
//

If you have problems or comments...

PBIL Back to PBIL home page