(data stored in ACNUC7421 zone)

EMBL: CP001115.PE228

CP001115.PE228       Location/Qualifiers
FT   CDS             complement(292759..293946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01732"
FT                   /product="conserved hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01732"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47627"
FT                   /db_xref="InterPro:IPR021516"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2I8"
FT                   /protein_id="ACO47627.1"
FT                   /translation="MLRILLAIAALSFSGASAQPEQVDTLRVQTQFASVPLTELRSGGP
FT                   PPNGIPPLGFQGDSQGFPDTKAAQFEPVKAAGSWLEPREPVILVTVAGETGIFPLQVLL
FT                   WHEIANVTLGRVPVAVTFCPLCNTALVADRRIPVGQEQLRRLKGNPQVKDGRVLVTFGV
FT                   SGLLYKSDLVMFDSATHSLWYQAMGRGIVGPLTGTQLRVYPSLIVSFAEAARDAPQARV
FT                   LSRRTGYTRDYGRNPYVGYDDVDEPPFLYSGPLDRRLAPKERVVTVSAGEAHTAYPFRT
FT                   LAQQRVVNDHIATIAIVVFWAPGTRSAMNTTSVNEGRDVGSGVVFSRRVGGRDLTFESR
FT                   NGTFRDRETGSTWSLTGRATDGPLRGTALKPFAHGNHFWFAWAAYVPRTEVYLPR"
     MLRILLAIAA LSFSGASAQP EQVDTLRVQT QFASVPLTEL RSGGPPPNGI PPLGFQGDSQ        60
     GFPDTKAAQF EPVKAAGSWL EPREPVILVT VAGETGIFPL QVLLWHEIAN VTLGRVPVAV       120
     TFCPLCNTAL VADRRIPVGQ EQLRRLKGNP QVKDGRVLVT FGVSGLLYKS DLVMFDSATH       180
     SLWYQAMGRG IVGPLTGTQL RVYPSLIVSF AEAARDAPQA RVLSRRTGYT RDYGRNPYVG       240
     YDDVDEPPFL YSGPLDRRLA PKERVVTVSA GEAHTAYPFR TLAQQRVVND HIATIAIVVF       300
     WAPGTRSAMN TTSVNEGRDV GSGVVFSRRV GGRDLTFESR NGTFRDRETG STWSLTGRAT       360
     DGPLRGTALK PFAHGNHFWF AWAAYVPRTE VYLPR                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page