(data stored in ACNUC7421 zone)

EMBL: CP001115.PE23

CP001115.PE23        Location/Qualifiers
FT   CDS             33119..35323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00170"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00170"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47413"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1X4"
FT                   /protein_id="ACO47413.2"
FT                   /translation="MTSSRQPSRGMCRACGYVGTKASMTKHQAGCASRQAPGGTTHDVF
FT                   RCRISGADLPAYWLDVELTPKATLDDLDRFLRDIWLECCGHLSSFTIGPHDNGDFGSFR
FT                   ASRRTRQPSLAELDLHPGDKFGYTYDFGSSTNLTVQVQAYESVSGEATDRIKLLARNLP
FT                   PISVCSLCSKPAKWVHTWESDDATGGPLLYCGSHGKKTRDEQLPVVNSPRMGVCGYEGG
FT                   SDESWPPHPSKLTAEHSPSEAELPAHTTSQDTTPAGNRSLLEQDGLDEALLAYVETLPL
FT                   QTETVWLVAIQEMPAILPPEEGRAAVVLVVDAASGQILTSEVMTDITTQAVQEAVLETM
FT                   LAPEADDIKPQRPGQIFTLDAELAFSLHTTLAALGIRVERRDSPELEELLAHLRDEVGS
FT                   GMRALVEGQRPRAFLHGVPDVDVRNLIETFARFMKAKPWRNFAPDKPLRASWTNPDGTS
FT                   SQLYAMVLGGLGEVYGLALYPDWLSYNKHVLNSFHPELVLLATGGLESLTLSQREEIHP
FT                   EDWERLRTAGLPARAQAGPALIRIGLTGTQPPTFPLQPLTEVLRILSERAERKASPVTS
FT                   LKAELGGVSVKYPADPRDELSAQERSGSVQVRVRSNAGHFTYNAEVVMTGPPETLVRNA
FT                   FAQARRLLDQKPGEGRNVYLPYRLESAGQALENSGFFEDLHVLIWENRPGSPALTLAHL
FT                   ASMGPLIDGELATIEVAPQAADVAGLTVELQAVDPGSGVS"
     MTSSRQPSRG MCRACGYVGT KASMTKHQAG CASRQAPGGT THDVFRCRIS GADLPAYWLD        60
     VELTPKATLD DLDRFLRDIW LECCGHLSSF TIGPHDNGDF GSFRASRRTR QPSLAELDLH       120
     PGDKFGYTYD FGSSTNLTVQ VQAYESVSGE ATDRIKLLAR NLPPISVCSL CSKPAKWVHT       180
     WESDDATGGP LLYCGSHGKK TRDEQLPVVN SPRMGVCGYE GGSDESWPPH PSKLTAEHSP       240
     SEAELPAHTT SQDTTPAGNR SLLEQDGLDE ALLAYVETLP LQTETVWLVA IQEMPAILPP       300
     EEGRAAVVLV VDAASGQILT SEVMTDITTQ AVQEAVLETM LAPEADDIKP QRPGQIFTLD       360
     AELAFSLHTT LAALGIRVER RDSPELEELL AHLRDEVGSG MRALVEGQRP RAFLHGVPDV       420
     DVRNLIETFA RFMKAKPWRN FAPDKPLRAS WTNPDGTSSQ LYAMVLGGLG EVYGLALYPD       480
     WLSYNKHVLN SFHPELVLLA TGGLESLTLS QREEIHPEDW ERLRTAGLPA RAQAGPALIR       540
     IGLTGTQPPT FPLQPLTEVL RILSERAERK ASPVTSLKAE LGGVSVKYPA DPRDELSAQE       600
     RSGSVQVRVR SNAGHFTYNA EVVMTGPPET LVRNAFAQAR RLLDQKPGEG RNVYLPYRLE       660
     SAGQALENSG FFEDLHVLIW ENRPGSPALT LAHLASMGPL IDGELATIEV APQAADVAGL       720
     TVELQAVDPG SGVS                                                         734
//

If you have problems or comments...

PBIL Back to PBIL home page