(data stored in ACNUC7421 zone)

EMBL: CP001115.PE231

CP001115.PE231       Location/Qualifiers
FT   CDS             296510..296881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01736"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01736"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47630"
FT                   /db_xref="InterPro:IPR027783"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2J1"
FT                   /protein_id="ACO47630.1"
FT                   /translation="MESVAIGLILLTLPPLLYIVSQKTGVRYTWTPDALQVDTGLRRYI
FT                   FPYATTTARLTTQPLGSRIWGTAVSGSVTGRYTLDSSTVQALATTARPAQALLLEAGQQ
FT                   TFYVTPERAEEFAARFLAK"
     MESVAIGLIL LTLPPLLYIV SQKTGVRYTW TPDALQVDTG LRRYIFPYAT TTARLTTQPL        60
     GSRIWGTAVS GSVTGRYTLD SSTVQALATT ARPAQALLLE AGQQTFYVTP ERAEEFAARF       120
     LAK                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page