(data stored in ACNUC7421 zone)

EMBL: CP001115.PE234

CP001115.PE234       Location/Qualifiers
FT   CDS             298849..300375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01751"
FT                   /product="putative Diguanylate cyclase (GGDEF domain) with
FT                   GAF sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01751"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47633"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2J4"
FT                   /protein_id="ACO47633.1"
FT                   /translation="MPSAPLPEQEYARLLELARYNILDTAPEESFDRLTRLAARTLRVP
FT                   GVILNFVDQGRQWRKSWFGDGETNCSREDSFCAWTILSDDVLAVSDAREDPRFHDYKLV
FT                   VGDPNIRMYAGAPLVTPSGHRIGSLCVFSAEARELDLDDQATLRDLAALVMDELELRLH
FT                   NHVLQSQINQQDQQLWELRQTVAHAQVLEDINGLTETATTPEEVTLAVAAKIGEAIHAD
FT                   WTGLIAFSGNDATIQVAHHQPDLSPALLAFASRLPQLPCGVTRGMRGVTHTAYIEDYRQ
FT                   HPDALQEGVDAGFKSAALVPLGQYGEIEFLLIAARAERGSRAAWRSSDRALLDAAGRTV
FT                   RAALVRRAALEASLLAARQDRLTGIANRRAFDHDLELRMQAGQPFTFALMDLDGFKQVN
FT                   DVEGHAQGDRVLQVFALALRDTVSSYGQVYRYGGDEFALLLDPLTDERALEHVDSAVLA
FT                   ARQVTTRFVGASVGIVQMGNEDNPYCPSELQQRADTRMYEVKRRRQAALN"
     MPSAPLPEQE YARLLELARY NILDTAPEES FDRLTRLAAR TLRVPGVILN FVDQGRQWRK        60
     SWFGDGETNC SREDSFCAWT ILSDDVLAVS DAREDPRFHD YKLVVGDPNI RMYAGAPLVT       120
     PSGHRIGSLC VFSAEARELD LDDQATLRDL AALVMDELEL RLHNHVLQSQ INQQDQQLWE       180
     LRQTVAHAQV LEDINGLTET ATTPEEVTLA VAAKIGEAIH ADWTGLIAFS GNDATIQVAH       240
     HQPDLSPALL AFASRLPQLP CGVTRGMRGV THTAYIEDYR QHPDALQEGV DAGFKSAALV       300
     PLGQYGEIEF LLIAARAERG SRAAWRSSDR ALLDAAGRTV RAALVRRAAL EASLLAARQD       360
     RLTGIANRRA FDHDLELRMQ AGQPFTFALM DLDGFKQVND VEGHAQGDRV LQVFALALRD       420
     TVSSYGQVYR YGGDEFALLL DPLTDERALE HVDSAVLAAR QVTTRFVGAS VGIVQMGNED       480
     NPYCPSELQQ RADTRMYEVK RRRQAALN                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page