(data stored in ACNUC7421 zone)

EMBL: CP001115.PE235

CP001115.PE235       Location/Qualifiers
FT   CDS             complement(300642..300974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01752"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01752"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47634"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2J5"
FT                   /protein_id="ACO47634.2"
FT                   /translation="MDLPAAKQVVQQIINDLSLPDGTRLGVDVDANPDRLNIIAISGRR
FT                   AGVVVITKEALEDHGHKAINAAIERLRRAIYDKDLPLLTGAPVQLGMLDSRGWTDGSVS
FT                   PYSNDS"
     MDLPAAKQVV QQIINDLSLP DGTRLGVDVD ANPDRLNIIA ISGRRAGVVV ITKEALEDHG        60
     HKAINAAIER LRRAIYDKDL PLLTGAPVQL GMLDSRGWTD GSVSPYSNDS                  110
//

If you have problems or comments...

PBIL Back to PBIL home page