(data stored in ACNUC7421 zone)

EMBL: CP001115.PE236

CP001115.PE236       Location/Qualifiers
FT   CDS             301668..302414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01770"
FT                   /product="putative universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01770"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47635"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2J6"
FT                   /protein_id="ACO47635.2"
FT                   /translation="MTSPGFSPLTYLVPLDGRVGPTWVTEQAIELASAHGGTVLGLSTL
FT                   KGPEAQNDLHSFQERCRVTGIAARSLHLPGPRFQGIMEASKRADLVMVAWTAESARVLD
FT                   FSTFGALVRHATCPVWIAPPSGRVPAELTVAFHGQRKAFHAIAQAAKLAQTWQLPVDTL
FT                   VVAEGPDINDHDTLIARQELRARNVIERHSRYERGVTGEILAAATSPDQLLIMGGAGDG
FT                   PFFGLTLSRIVRQVLRLPRGPVLICP"
     MTSPGFSPLT YLVPLDGRVG PTWVTEQAIE LASAHGGTVL GLSTLKGPEA QNDLHSFQER        60
     CRVTGIAARS LHLPGPRFQG IMEASKRADL VMVAWTAESA RVLDFSTFGA LVRHATCPVW       120
     IAPPSGRVPA ELTVAFHGQR KAFHAIAQAA KLAQTWQLPV DTLVVAEGPD INDHDTLIAR       180
     QELRARNVIE RHSRYERGVT GEILAAATSP DQLLIMGGAG DGPFFGLTLS RIVRQVLRLP       240
     RGPVLICP                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page