(data stored in ACNUC7421 zone)

EMBL: CP001115.PE239

CP001115.PE239       Location/Qualifiers
FT   CDS             307377..308738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01800"
FT                   /product="putative plasmid replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01800"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47639"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2K0"
FT                   /protein_id="ACO47639.1"
FT                   /translation="MTSPPSRFDELNLSRLNLISAVDQAEVSEWDVTFEAHGRIVHVRC
FT                   EALPKYAVPHGLDSDVTAALINLYIELGEPEDGRFSVSATTLLKLCGWHNTGKYHGILR
FT                   VCLERLHTSSYSVSGGWRDHPKGRWTHAKFHFIESLDFSSSDGAGAFDDRTIIAGRLAD
FT                   VIVASIRSGYVKPLDTEFMLSLSRPRTRALYRILDGARYDPDHPDVRLDTLEFNLIQWA
FT                   DQCKIPSTIPGNIRRALASPHEELIKRGYLRAATLSGRGKDQRVRYEFVREFVAMDAVL
FT                   ARRFRSYGVADGVARKLLVEHGRDALIASMDRFDGLVRQGVLVVKKTPAAALMHLINHP
FT                   DDYPYPKGAPAAPAPVRPARVEPVMEAPSVEAEFASLSLEQAAERLISRMNVHYRKLLS
FT                   VSDLDTLRQAVMKELLSPSAVLEEATAAVVKLQRENFAQTLRARLGLPEERPIK"
     MTSPPSRFDE LNLSRLNLIS AVDQAEVSEW DVTFEAHGRI VHVRCEALPK YAVPHGLDSD        60
     VTAALINLYI ELGEPEDGRF SVSATTLLKL CGWHNTGKYH GILRVCLERL HTSSYSVSGG       120
     WRDHPKGRWT HAKFHFIESL DFSSSDGAGA FDDRTIIAGR LADVIVASIR SGYVKPLDTE       180
     FMLSLSRPRT RALYRILDGA RYDPDHPDVR LDTLEFNLIQ WADQCKIPST IPGNIRRALA       240
     SPHEELIKRG YLRAATLSGR GKDQRVRYEF VREFVAMDAV LARRFRSYGV ADGVARKLLV       300
     EHGRDALIAS MDRFDGLVRQ GVLVVKKTPA AALMHLINHP DDYPYPKGAP AAPAPVRPAR       360
     VEPVMEAPSV EAEFASLSLE QAAERLISRM NVHYRKLLSV SDLDTLRQAV MKELLSPSAV       420
     LEEATAAVVK LQRENFAQTL RARLGLPEER PIK                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page