(data stored in ACNUC7421 zone)

EMBL: CP001115.PE242

CP001115.PE242       Location/Qualifiers
FT   CDS             complement(312054..312938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01820"
FT                   /product="putative transglutaminase/protease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01820"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47642"
FT                   /db_xref="GOA:C1D2K3"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2K3"
FT                   /protein_id="ACO47642.1"
FT                   /translation="MSSDECSDVIHVRVGFHLTFDLPFTTPMLFVVEPQNRPGQQIVQT
FT                   REYLDPSAGVGRWSRYTDVFGNSIWRVLGVGHTLQVGQDVIVQVPAHSDPQHPDLPKTP
FT                   VEDLPDEVLQFLLPSRYVDSDLISNEAWERFGHIQGGWAQVQAISHHLYSTCSYGAAST
FT                   SSTTAQQAYQSGRAVCRDFAHMGVAFCRALNIPARYVCGYLGDIGVPSTDTPMDFHAWF
FT                   EAWIDGAWRTFDARHNKPRTGRVLIATGRDAADVAFTTSFGAARLTRMQVWADQVDPGF
FT                   TLPDTWAPPQPRA"
     MSSDECSDVI HVRVGFHLTF DLPFTTPMLF VVEPQNRPGQ QIVQTREYLD PSAGVGRWSR        60
     YTDVFGNSIW RVLGVGHTLQ VGQDVIVQVP AHSDPQHPDL PKTPVEDLPD EVLQFLLPSR       120
     YVDSDLISNE AWERFGHIQG GWAQVQAISH HLYSTCSYGA ASTSSTTAQQ AYQSGRAVCR       180
     DFAHMGVAFC RALNIPARYV CGYLGDIGVP STDTPMDFHA WFEAWIDGAW RTFDARHNKP       240
     RTGRVLIATG RDAADVAFTT SFGAARLTRM QVWADQVDPG FTLPDTWAPP QPRA             294
//

If you have problems or comments...

PBIL Back to PBIL home page