(data stored in ACNUC7421 zone)

EMBL: CP001115.PE243

CP001115.PE243       Location/Qualifiers
FT   CDS             313245..315047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01830"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47643"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2K4"
FT                   /protein_id="ACO47643.1"
FT                   /translation="MEQYDQGTTFFDEMFTPQGQVRPHYQGVLSYFRRLGTTEFQRRQA
FT                   LMDLAFRNQGITFTVYGDSAGVERTFPFDPVPRIIPASEWSALEAGLKQRVKALNAFLR
FT                   DVYSDGQILKDGIIPRELVYTSSNFRREVHGLQVPLGIYTHIVGSDLIRDEQGRYLVLE
FT                   DNLRSPSGVSYLLANRQAMTRIFPGMFERQGVRTVDHYTTALLGVLSSLSPRAPEATVV
FT                   VLTPGMYNSAYFEHAYLAQQMGVELVEGRDLFVDGGRVWMRTTSGRTQVDVIYRRIDDD
FT                   FLDPLTFRRDSALGVPGLVEVYRQGRVAIANAIGAGVADDKAVYAYVPRMIEYYLGEQP
FT                   LLDNVPTFLGWNPDHLAYMLDNAAELVIKAVGEAGGYGMLIGPAATREETEDFLKNVRA
FT                   NPRNYIAQPVIGLSRHPTFYPDARAFEPAHVDLRPYILVGQEVTIVPGGLTRVALRRGS
FT                   LVVNSSQGGGSKDTWVLNHDGPAPARIQQQFQGATEPQEPHPAVPGEVKVEAQAGHTQV
FT                   QSLGRMMQEQSLGGAQAHSRSPSLVQEEDPQSSTAGQHQWQGAAGEPLSAEERDEAGAP
FT                   DSGVSDMLTSGQSGPGPADPKGDI"
     MEQYDQGTTF FDEMFTPQGQ VRPHYQGVLS YFRRLGTTEF QRRQALMDLA FRNQGITFTV        60
     YGDSAGVERT FPFDPVPRII PASEWSALEA GLKQRVKALN AFLRDVYSDG QILKDGIIPR       120
     ELVYTSSNFR REVHGLQVPL GIYTHIVGSD LIRDEQGRYL VLEDNLRSPS GVSYLLANRQ       180
     AMTRIFPGMF ERQGVRTVDH YTTALLGVLS SLSPRAPEAT VVVLTPGMYN SAYFEHAYLA       240
     QQMGVELVEG RDLFVDGGRV WMRTTSGRTQ VDVIYRRIDD DFLDPLTFRR DSALGVPGLV       300
     EVYRQGRVAI ANAIGAGVAD DKAVYAYVPR MIEYYLGEQP LLDNVPTFLG WNPDHLAYML       360
     DNAAELVIKA VGEAGGYGML IGPAATREET EDFLKNVRAN PRNYIAQPVI GLSRHPTFYP       420
     DARAFEPAHV DLRPYILVGQ EVTIVPGGLT RVALRRGSLV VNSSQGGGSK DTWVLNHDGP       480
     APARIQQQFQ GATEPQEPHP AVPGEVKVEA QAGHTQVQSL GRMMQEQSLG GAQAHSRSPS       540
     LVQEEDPQSS TAGQHQWQGA AGEPLSAEER DEAGAPDSGV SDMLTSGQSG PGPADPKGDI       600
//

If you have problems or comments...

PBIL Back to PBIL home page