(data stored in ACNUC7421 zone)

EMBL: CP001115.PE244

CP001115.PE244       Location/Qualifiers
FT   CDS             315047..315979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01840"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47644"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2K5"
FT                   /protein_id="ACO47644.1"
FT                   /translation="MLSRLAESLYWIGRYMERAENTARLLTVNYYATLETSGQVSEEWG
FT                   PLLDISGSKENFVRLHGRADGRTVPAWLAFDRNNPSSVSSSLAQARENARGLRDRIPSE
FT                   MWECLNRAYYDLCFQNEEVLDRDGLFEFCSAARDTSQFFFGIAFATLPRDEGWLFMRAG
FT                   QMLERGDNVLRLVQTRYRSHAADPAQLAVHNHRWIAVLKTASAYEAYRKCNHANVSPRT
FT                   IAEFLLLNPGFPRSVRYSGENLHDALAGIDRIHPGAHPALLREAKWLVARLDHATIEEL
FT                   IARDQAELGTLLTDFNRIGSAISASYFTV"
     MLSRLAESLY WIGRYMERAE NTARLLTVNY YATLETSGQV SEEWGPLLDI SGSKENFVRL        60
     HGRADGRTVP AWLAFDRNNP SSVSSSLAQA RENARGLRDR IPSEMWECLN RAYYDLCFQN       120
     EEVLDRDGLF EFCSAARDTS QFFFGIAFAT LPRDEGWLFM RAGQMLERGD NVLRLVQTRY       180
     RSHAADPAQL AVHNHRWIAV LKTASAYEAY RKCNHANVSP RTIAEFLLLN PGFPRSVRYS       240
     GENLHDALAG IDRIHPGAHP ALLREAKWLV ARLDHATIEE LIARDQAELG TLLTDFNRIG       300
     SAISASYFTV                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page