(data stored in ACNUC7421 zone)

EMBL: CP001115.PE245

CP001115.PE245       Location/Qualifiers
FT   CDS             316007..316852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01850"
FT                   /product="putative transglutaminase/protease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01850"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47645"
FT                   /db_xref="GOA:C1D2K6"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2K6"
FT                   /protein_id="ACO47645.1"
FT                   /translation="MRADIRHITEYRYAEPAWDSFNEVRLSPEVSARQDLRSFHLAVRP
FT                   EPSLVSTHRDYFGSLIHHVHVHEPHQVLRIEAQALVITRPLPGLETVPFSALDELRGEV
FT                   TEFLVSSPRVPSGRWPEVFGVRAPQPHEDLSAFMVALTTQLHRQFTYHPGATSVSTTLE
FT                   QFARDLRGVCQDYTHAMLGICRTLGIPARYVSGYLYSGGEMIGADATHAWVEVLIPGQG
FT                   WVGFDPTNDMLAGEKHIKIGHGRDYPDVSPVRGTYYGGGGEASLNVEVRVYGDPPARQE
FT                   "
     MRADIRHITE YRYAEPAWDS FNEVRLSPEV SARQDLRSFH LAVRPEPSLV STHRDYFGSL        60
     IHHVHVHEPH QVLRIEAQAL VITRPLPGLE TVPFSALDEL RGEVTEFLVS SPRVPSGRWP       120
     EVFGVRAPQP HEDLSAFMVA LTTQLHRQFT YHPGATSVST TLEQFARDLR GVCQDYTHAM       180
     LGICRTLGIP ARYVSGYLYS GGEMIGADAT HAWVEVLIPG QGWVGFDPTN DMLAGEKHIK       240
     IGHGRDYPDV SPVRGTYYGG GGEASLNVEV RVYGDPPARQ E                           281
//

If you have problems or comments...

PBIL Back to PBIL home page