(data stored in ACNUC7421 zone)

EMBL: CP001115.PE249

CP001115.PE249       Location/Qualifiers
FT   CDS             319477..319719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01890"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47649"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2L0"
FT                   /protein_id="ACO47649.1"
FT                   /translation="MKAVQQQVEVEVRNGQPARLIWNGQTYPVQAVLDWWRAGGRWWLG
FT                   EAPRNCYFVQAGSLTAELHHEDAQEGRWWLARVQD"
     MKAVQQQVEV EVRNGQPARL IWNGQTYPVQ AVLDWWRAGG RWWLGEAPRN CYFVQAGSLT        60
     AELHHEDAQE GRWWLARVQD                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page