(data stored in ACNUC7421 zone)

EMBL: CP001115.PE250

CP001115.PE250       Location/Qualifiers
FT   CDS             319695..322871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01900"
FT                   /product="putative DNA polymerase III alpha subunit;
FT                   putative Error-prone DNA polymerase dnaE2"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01900"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47650"
FT                   /db_xref="GOA:C1D2L1"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR023073"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2L1"
FT                   /protein_id="ACO47650.1"
FT                   /translation="MAGQSAGLGVPRLQVLLACQSYFSEGRSTVSPRRLVQRAADAGYS
FT                   AVGLADWCSVAGAVELGEAARAAGLAALVGVTLPVLFPAPPRSPAPYEPYPVVLLARDR
FT                   PGYAVLCRLITDVQGQYPGGLPLSLLQETGRQFQDHLLCLTGGRTGFPTVLGEQREVAR
FT                   AAFYLRTLRGIFPFSLYVQLYHGAAPNERRRLEYLRGLARDLELPVVAAPEVCMADAAD
FT                   YCLLDALTCARLGIDVQTPHPDRPRNDARHVGTPEEWGHLLPFPDALLNAERIADWCTF
FT                   ELLPERLRSPEPRLRPFQTAQEVLEERVFAAVGSRYSPGAREAALRRLKDELATVAHLD
FT                   LAGFFLTAAEVTDYCREHGILAAGRGSAAGSVLCYLLGITLSDPIEHNLLFERFLHTGR
FT                   TSMPDVDIDIASARRDQVLRWVEERWGLSGAGEAMVANRITYRMKSAIQDLGRALGMPP
FT                   DLRDRLSRALGRDYGHLRPHRAREAEVAFTEVLGDAPVKEALLCLLERIEPGFVRHLAP
FT                   HSGGVVLSSEPLTFYSPLTRSSGGIRMLTFDKDDVEKLGLIKLDLLGLRMLAALERARE
FT                   EVLRLTNEWVPYGELPDDPRVWAEISSGDTMGLFQIESPAQVQMTARLQPKTMTQLAHQ
FT                   VALVRPGPIQSGTVHPYVRRARGEEPVPERPEPLQSILRATHGTLMFQEQILRIAVHYA
FT                   GYDWPHADRFRSRLSKVEDGHELAELKEQFLSGAALTCGAFPWEAEEVFEMCAMFRGYG
FT                   FAESHAHAFAQHSYASAYMRHHYPAAYFAAFLTEAPGMWPANTIAQECRRRGVTLLPVC
FT                   INRSGLSYRAESLRTIRVPLTAVEGISEAKAREIVHERLIGGKFSTLEDAYDRIDLSRD
FT                   RFEKLVLAGGLTSIEPSRRKGLFGLTLLANARKAGTRPLLAPGIEPPELPEMSSTEYLA
FT                   LDLRTKGLSETGRHPLDAHRARLRDLGCQALGGLNHGDTAWVAGVIVARQRPPTAKGFA
FT                   FYVLEDRTARLQAIISPDLWEANRVLLRDARALIVCGPVTRLGQAITIKVQRLSELPLR
FT                   WPEPDVEAAD"
     MAGQSAGLGV PRLQVLLACQ SYFSEGRSTV SPRRLVQRAA DAGYSAVGLA DWCSVAGAVE        60
     LGEAARAAGL AALVGVTLPV LFPAPPRSPA PYEPYPVVLL ARDRPGYAVL CRLITDVQGQ       120
     YPGGLPLSLL QETGRQFQDH LLCLTGGRTG FPTVLGEQRE VARAAFYLRT LRGIFPFSLY       180
     VQLYHGAAPN ERRRLEYLRG LARDLELPVV AAPEVCMADA ADYCLLDALT CARLGIDVQT       240
     PHPDRPRNDA RHVGTPEEWG HLLPFPDALL NAERIADWCT FELLPERLRS PEPRLRPFQT       300
     AQEVLEERVF AAVGSRYSPG AREAALRRLK DELATVAHLD LAGFFLTAAE VTDYCREHGI       360
     LAAGRGSAAG SVLCYLLGIT LSDPIEHNLL FERFLHTGRT SMPDVDIDIA SARRDQVLRW       420
     VEERWGLSGA GEAMVANRIT YRMKSAIQDL GRALGMPPDL RDRLSRALGR DYGHLRPHRA       480
     REAEVAFTEV LGDAPVKEAL LCLLERIEPG FVRHLAPHSG GVVLSSEPLT FYSPLTRSSG       540
     GIRMLTFDKD DVEKLGLIKL DLLGLRMLAA LERAREEVLR LTNEWVPYGE LPDDPRVWAE       600
     ISSGDTMGLF QIESPAQVQM TARLQPKTMT QLAHQVALVR PGPIQSGTVH PYVRRARGEE       660
     PVPERPEPLQ SILRATHGTL MFQEQILRIA VHYAGYDWPH ADRFRSRLSK VEDGHELAEL       720
     KEQFLSGAAL TCGAFPWEAE EVFEMCAMFR GYGFAESHAH AFAQHSYASA YMRHHYPAAY       780
     FAAFLTEAPG MWPANTIAQE CRRRGVTLLP VCINRSGLSY RAESLRTIRV PLTAVEGISE       840
     AKAREIVHER LIGGKFSTLE DAYDRIDLSR DRFEKLVLAG GLTSIEPSRR KGLFGLTLLA       900
     NARKAGTRPL LAPGIEPPEL PEMSSTEYLA LDLRTKGLSE TGRHPLDAHR ARLRDLGCQA       960
     LGGLNHGDTA WVAGVIVARQ RPPTAKGFAF YVLEDRTARL QAIISPDLWE ANRVLLRDAR      1020
     ALIVCGPVTR LGQAITIKVQ RLSELPLRWP EPDVEAAD                              1058
//

If you have problems or comments...

PBIL Back to PBIL home page