(data stored in ACNUC7421 zone)

EMBL: CP001115.PE251

CP001115.PE251       Location/Qualifiers
FT   CDS             322985..323425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p01905"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01905"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26557"
FT                   /db_xref="UniProtKB/TrEMBL:X5HN84"
FT                   /protein_id="AHX26557.1"
FT                   /translation="MSDRQPPNKSSAHGNTASFRCETGPETLFDRVRFKMAGARRLKFY
FT                   SAQFRRRLVEEGVPMEELQQFDPEHWDLIAADVRTDTGKFINSTWVCSADQRRWRVVIG
FT                   FKDTIERVTGLEKDAPTPDAVTSGTLYKKVAKVNGELMDAEA"
     MSDRQPPNKS SAHGNTASFR CETGPETLFD RVRFKMAGAR RLKFYSAQFR RRLVEEGVPM        60
     EELQQFDPEH WDLIAADVRT DTGKFINSTW VCSADQRRWR VVIGFKDTIE RVTGLEKDAP       120
     TPDAVTSGTL YKKVAKVNGE LMDAEA                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page