(data stored in ACNUC7421 zone)

EMBL: CP001115.PE26

CP001115.PE26        Location/Qualifiers
FT   CDS             complement(38451..41249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00200"
FT                   /product="putative histidine kinase, classic"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00200"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47416"
FT                   /db_xref="GOA:C1D1X7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1X7"
FT                   /protein_id="ACO47416.1"
FT                   /translation="MTVSNSQGNDLLTSDLLSVALDAFIGIDQHGRVIEWNPAAERTFG
FT                   YTRQEALGQAMNELIIPPAFQAAHQHGMARYLETGLAKVLYQRLRLEAQRRDGEIFPCE
FT                   LVIHEVQIQGARSFIASLRDLTEQVRAETALRKREADHRTLIENTAVGVARVDIEGRWL
FT                   EVNPAIERFLGYSEAELRGLTFRDVSHPDDLSQHNVGLFSRLVNGEGGTFTLEKRYIRK
FT                   DGVVVWGSVTVSPVVDPVTGYRSTVAVIHDITDRKRAEEYTERLHRVTADLARALTPEA
FT                   VLDVTLAEVMPAMGAAAGGALLIDDSEDYLEALGHAGYSEEMERRFSRVPLTMSLPVTD
FT                   TARTGEPYFLTSQELLERYPHLAGQREQFRSGAGLPLRVGDQITGVLVLSFSDDRLFSG
FT                   ADQTFMTSVADQCAQAIERARLYEVSRISVQRYRSLVETTSRIVWTRSPEGTFDHDQPQ
FT                   WTAFTGQRSPELLGMGWLDAVHPEDRARTADSWQNAVSSGTPYETKYRLRRADGMFRHM
FT                   HVRAIPLRDDDGTLREWIGVHTDITERLEAELALRESQGRLRFALEAAQLGDWEMSLHD
FT                   HSFRQSPRHDEIFGYPQGRPHWTYETFLEHVLPEDREDVNRKFTWAMEQEEAWDIECRI
FT                   RRADGEVRWIWTRGQAQKQPHGRARHMLGIVGDITVLKRAEAEVRALNVTLEQRVRERT
FT                   QELERSNRDLEQFAYVASHDLQEPLRTVTSYTELLARRYGGQLDEKAEKYMTFTVAAAR
FT                   RMGQLVQDLLDFSRVRAENHQVSRLDPNEVMVTLIRDLEETIEANGAAVSWDNLPAVHA
FT                   DAVQFRQLLQNLIGNGLKFHRDGVAPAVHVSARIEGQSAHFQVQDNGIGIERQYFDRIF
FT                   AVFQRLHTRDRYQGTGVGLALCKRIVERHGGQIWLDSVPGEGTTFHFTLQLPLTETEAA
FT                   GV"
     MTVSNSQGND LLTSDLLSVA LDAFIGIDQH GRVIEWNPAA ERTFGYTRQE ALGQAMNELI        60
     IPPAFQAAHQ HGMARYLETG LAKVLYQRLR LEAQRRDGEI FPCELVIHEV QIQGARSFIA       120
     SLRDLTEQVR AETALRKREA DHRTLIENTA VGVARVDIEG RWLEVNPAIE RFLGYSEAEL       180
     RGLTFRDVSH PDDLSQHNVG LFSRLVNGEG GTFTLEKRYI RKDGVVVWGS VTVSPVVDPV       240
     TGYRSTVAVI HDITDRKRAE EYTERLHRVT ADLARALTPE AVLDVTLAEV MPAMGAAAGG       300
     ALLIDDSEDY LEALGHAGYS EEMERRFSRV PLTMSLPVTD TARTGEPYFL TSQELLERYP       360
     HLAGQREQFR SGAGLPLRVG DQITGVLVLS FSDDRLFSGA DQTFMTSVAD QCAQAIERAR       420
     LYEVSRISVQ RYRSLVETTS RIVWTRSPEG TFDHDQPQWT AFTGQRSPEL LGMGWLDAVH       480
     PEDRARTADS WQNAVSSGTP YETKYRLRRA DGMFRHMHVR AIPLRDDDGT LREWIGVHTD       540
     ITERLEAELA LRESQGRLRF ALEAAQLGDW EMSLHDHSFR QSPRHDEIFG YPQGRPHWTY       600
     ETFLEHVLPE DREDVNRKFT WAMEQEEAWD IECRIRRADG EVRWIWTRGQ AQKQPHGRAR       660
     HMLGIVGDIT VLKRAEAEVR ALNVTLEQRV RERTQELERS NRDLEQFAYV ASHDLQEPLR       720
     TVTSYTELLA RRYGGQLDEK AEKYMTFTVA AARRMGQLVQ DLLDFSRVRA ENHQVSRLDP       780
     NEVMVTLIRD LEETIEANGA AVSWDNLPAV HADAVQFRQL LQNLIGNGLK FHRDGVAPAV       840
     HVSARIEGQS AHFQVQDNGI GIERQYFDRI FAVFQRLHTR DRYQGTGVGL ALCKRIVERH       900
     GGQIWLDSVP GEGTTFHFTL QLPLTETEAA GV                                     932
//

If you have problems or comments...

PBIL Back to PBIL home page