(data stored in ACNUC7421 zone)

EMBL: CP001115.PE3

CP001115.PE3         Location/Qualifiers
FT   CDS             2056..2532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00021"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00021"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47392"
FT                   /db_xref="GOA:C1D1V3"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1V3"
FT                   /protein_id="ACO47392.1"
FT                   /translation="MSGTDESSTIEPFDDLLQEIRVLLSGSQVLTAFLVTLPFSSGFAR
FT                   LDATERNVYAATFLAALLSLVLFATPAAYHRLVWPVPNRRRFKQLGTKLVVVGLIPLSA
FT                   SWILATHLVLGEVLNSRLSNVITTFVALVIGALWWAWPLIRRTRMEGQSSQQRG"
     MSGTDESSTI EPFDDLLQEI RVLLSGSQVL TAFLVTLPFS SGFARLDATE RNVYAATFLA        60
     ALLSLVLFAT PAAYHRLVWP VPNRRRFKQL GTKLVVVGLI PLSASWILAT HLVLGEVLNS       120
     RLSNVITTFV ALVIGALWWA WPLIRRTRME GQSSQQRG                               158
//

If you have problems or comments...

PBIL Back to PBIL home page