(data stored in ACNUC7421 zone)

EMBL: CP001115.PE30

CP001115.PE30        Location/Qualifiers
FT   CDS             44748..49019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00240"
FT                   /product="putative histidine kinase, classic"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00240"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47420"
FT                   /db_xref="GOA:C1D1Y1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1Y1"
FT                   /protein_id="ACO47420.2"
FT                   /translation="MSRPQEELIGEAFTAPPGLFEAVFTHSSCAMGVLDRSLQIVSGNP
FT                   ALAALIGQPLHAFVGRPLAEVFGPLPAHVLEAYDQVLQGGSSQKELTFPTSQNPHQLLS
FT                   TIAYPVAETPAGITGLIATFALAHKDTWQTPEHSCQLAKLGHSLATALTGNDVSRVILE
FT                   QAGPILGAYGGTLIRVLDKHMLYMEGSFGYGTQVEDTWQPFPTESGYPVVQAVENRDAV
FT                   FVTVSELPQRFPAIVPLLLPETRAIAVLPLLSEQGVPSVLSLSFRDEQDIAADRRDFML
FT                   ELAALCARALERARRYDADLLARERATLLANASSLLSASLDVQETLQRITSLAIEHVAD
FT                   WCAVYQPDDTGRICPVVVAHKDAQKEELLRSLLNHFPSDPEIYGTSGWVVRTGESVLIP
FT                   VIPAAMVESLPTEVHRDAMRNLGFHSLILVPMTVRGRRTGVLGVATTHPSRTFVHDDLE
FT                   LARQLSERAALALDNARRYATVRTGEERYRSLVDATRQTVWTNTPDGRLLGDQPGWARL
FT                   TGQTREEYEGFGWAAVLHPDDQERSVAAWHQAVASASPYEINQRVRVADGSYRHFHVRV
FT                   VPALGQDGSVREWTGVHTDITERVRAEQELRDREERYRVLVEYAAVGVARVLPDGRWLD
FT                   INPAGEALLGYTREELLGRTLLDVTHPDDRGPEGTRPFRRLVAGEVDAFSQEKRYVRKD
FT                   GQLVWTKVTVSAVRDEAGATQYVVAILNDISEQKKAEDLLRASEERFRQLVGSSPTGIA
FT                   VGSIDGTLRFPNAAYLEMLGFTLEDFDAGLVNWAALTPPEYRSADENAFRQAFESGVSR
FT                   PYEKEMLDRYGRRVPVGLVLTRYEQHDETFVVGYVQDLTLHKAAQRTLREHGEELERRV
FT                   AERTHALEEQRAALDAFVRFTELAAAATGLAELTRHAVDVLRATIGPVSVAYYERHDML
FT                   WKAVTWSEDIPEVALAMIRGGVPLDQPSFAQVVQDQQAFYMEEWDAQGEQLGGFRMYGA
FT                   GALYPFFIDGQAHGLLNMASFSQRTWTPRDKAIFRAVGRSFALALERREQTAQLEAQKA
FT                   ELDMRTQALEQDQGFLRTLLESLTEGIVACDAQGHLTVFNDVTRAFHGLGPEPLPPAAW
FT                   AERFDLYREDGVTPLPTEEIPLFRAFQGQRVRDQGMVIAPKNGPRRWINANGNPMYSLT
FT                   GEKLGAVIAMQDVTARRQAEQELQRVNVELQRSNADLEHFAAVASHDLKSPLRTIRSYL
FT                   ELIERRLTGQLDERSMRYMGFATEAAARMDTLIDDLLAYARVGRQRNITRVEPQRVVQE
FT                   VLGGLTASIQERGAQIRVGDLMPVQADESQLRQVFQNLVGNALKFQPEGRVPEVMIDAT
FT                   RDGRYVLFQVRDNGIGISEEYYERVFALFQQLHGKSEFPGSGLGLAIVRKIIEEHDGRI
FT                   WLTSVVGEGTTFHFTLPSSDT"
     MSRPQEELIG EAFTAPPGLF EAVFTHSSCA MGVLDRSLQI VSGNPALAAL IGQPLHAFVG        60
     RPLAEVFGPL PAHVLEAYDQ VLQGGSSQKE LTFPTSQNPH QLLSTIAYPV AETPAGITGL       120
     IATFALAHKD TWQTPEHSCQ LAKLGHSLAT ALTGNDVSRV ILEQAGPILG AYGGTLIRVL       180
     DKHMLYMEGS FGYGTQVEDT WQPFPTESGY PVVQAVENRD AVFVTVSELP QRFPAIVPLL       240
     LPETRAIAVL PLLSEQGVPS VLSLSFRDEQ DIAADRRDFM LELAALCARA LERARRYDAD       300
     LLARERATLL ANASSLLSAS LDVQETLQRI TSLAIEHVAD WCAVYQPDDT GRICPVVVAH       360
     KDAQKEELLR SLLNHFPSDP EIYGTSGWVV RTGESVLIPV IPAAMVESLP TEVHRDAMRN       420
     LGFHSLILVP MTVRGRRTGV LGVATTHPSR TFVHDDLELA RQLSERAALA LDNARRYATV       480
     RTGEERYRSL VDATRQTVWT NTPDGRLLGD QPGWARLTGQ TREEYEGFGW AAVLHPDDQE       540
     RSVAAWHQAV ASASPYEINQ RVRVADGSYR HFHVRVVPAL GQDGSVREWT GVHTDITERV       600
     RAEQELRDRE ERYRVLVEYA AVGVARVLPD GRWLDINPAG EALLGYTREE LLGRTLLDVT       660
     HPDDRGPEGT RPFRRLVAGE VDAFSQEKRY VRKDGQLVWT KVTVSAVRDE AGATQYVVAI       720
     LNDISEQKKA EDLLRASEER FRQLVGSSPT GIAVGSIDGT LRFPNAAYLE MLGFTLEDFD       780
     AGLVNWAALT PPEYRSADEN AFRQAFESGV SRPYEKEMLD RYGRRVPVGL VLTRYEQHDE       840
     TFVVGYVQDL TLHKAAQRTL REHGEELERR VAERTHALEE QRAALDAFVR FTELAAAATG       900
     LAELTRHAVD VLRATIGPVS VAYYERHDML WKAVTWSEDI PEVALAMIRG GVPLDQPSFA       960
     QVVQDQQAFY MEEWDAQGEQ LGGFRMYGAG ALYPFFIDGQ AHGLLNMASF SQRTWTPRDK      1020
     AIFRAVGRSF ALALERREQT AQLEAQKAEL DMRTQALEQD QGFLRTLLES LTEGIVACDA      1080
     QGHLTVFNDV TRAFHGLGPE PLPPAAWAER FDLYREDGVT PLPTEEIPLF RAFQGQRVRD      1140
     QGMVIAPKNG PRRWINANGN PMYSLTGEKL GAVIAMQDVT ARRQAEQELQ RVNVELQRSN      1200
     ADLEHFAAVA SHDLKSPLRT IRSYLELIER RLTGQLDERS MRYMGFATEA AARMDTLIDD      1260
     LLAYARVGRQ RNITRVEPQR VVQEVLGGLT ASIQERGAQI RVGDLMPVQA DESQLRQVFQ      1320
     NLVGNALKFQ PEGRVPEVMI DATRDGRYVL FQVRDNGIGI SEEYYERVFA LFQQLHGKSE      1380
     FPGSGLGLAI VRKIIEEHDG RIWLTSVVGE GTTFHFTLPS SDT                        1423
//

If you have problems or comments...

PBIL Back to PBIL home page