(data stored in ACNUC7421 zone)

EMBL: CP001115.PE31

CP001115.PE31        Location/Qualifiers
FT   CDS             49451..50572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00250"
FT                   /product="putative diguanylate cyclase domain protein;
FT                   putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00250"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47421"
FT                   /db_xref="GOA:C1D1Y2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1Y2"
FT                   /protein_id="ACO47421.1"
FT                   /translation="MAQLRTDGAAPHGHSPSADHLQTVRVTLPIAALATLVAYFVERSD
FT                   LRYDPFDELAYPLILAGVLLLEGLLLIRPQAYTLVTRSTLLGFSAFFLLKLAYLLFFSR
FT                   NPTDLPSELNESFFWTPAIFLFAFITPQARLGQAVSVSFMALMIMISVIYAAASWGTSD
FT                   LHVLNALVQLNLANLTCLMLAGVVVRLTARHEATVVHARTFEQLAYTDALTGLPNRRYF
FT                   EQELDSALAAAGEVTPPQPLSVIFMDLDGFKQVNDTYGHDVGDQVLKVVAERLRSTFRG
FT                   GELIVRLSGDEFAALIPTATPEGMQAIRSRVAEALGKPIALGGQELHIAASLGFSVFPE
FT                   HGTDVRTLLHHADTAMYGMKSHRTVKQDEDGQV"
     MAQLRTDGAA PHGHSPSADH LQTVRVTLPI AALATLVAYF VERSDLRYDP FDELAYPLIL        60
     AGVLLLEGLL LIRPQAYTLV TRSTLLGFSA FFLLKLAYLL FFSRNPTDLP SELNESFFWT       120
     PAIFLFAFIT PQARLGQAVS VSFMALMIMI SVIYAAASWG TSDLHVLNAL VQLNLANLTC       180
     LMLAGVVVRL TARHEATVVH ARTFEQLAYT DALTGLPNRR YFEQELDSAL AAAGEVTPPQ       240
     PLSVIFMDLD GFKQVNDTYG HDVGDQVLKV VAERLRSTFR GGELIVRLSG DEFAALIPTA       300
     TPEGMQAIRS RVAEALGKPI ALGGQELHIA ASLGFSVFPE HGTDVRTLLH HADTAMYGMK       360
     SHRTVKQDED GQV                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page