(data stored in ACNUC7421 zone)

EMBL: CP001115.PE34

CP001115.PE34        Location/Qualifiers
FT   CDS             complement(53846..54235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00280"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00280"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47424"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1Y5"
FT                   /protein_id="ACO47424.1"
FT                   /translation="MVEALGVTFAWSTSEDALSFRSEWDPVPWVTYHSTMIFSDGFLRG
FT                   LRLDPTDLEVCGVGRNVYRCMRFGSFWMVQSPEGLGNESAALTWDAINGRYAADQALVF
FT                   ALQRVSGMHQDAVQAWLDDGARRRS"
     MVEALGVTFA WSTSEDALSF RSEWDPVPWV TYHSTMIFSD GFLRGLRLDP TDLEVCGVGR        60
     NVYRCMRFGS FWMVQSPEGL GNESAALTWD AINGRYAADQ ALVFALQRVS GMHQDAVQAW       120
     LDDGARRRS                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page