(data stored in ACNUC7421 zone)

EMBL: CP001115.PE4

CP001115.PE4         Location/Qualifiers
FT   CDS             2707..3528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00030"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00030"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47393"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1V4"
FT                   /protein_id="ACO47393.1"
FT                   /translation="MTNTASRRFDNRVVLVTGAAGGIGRAVAERFASEGARVAVNDIQV
FT                   NAVREVVGSITASGGSALAVPADVADASQVDHMFTQIESTFGYVDVLYNNAGLIDTARH
FT                   FLEADEAWWDRIIQVNLKSVFLCSHRAARTMVRRRRGVIISTSSGGATRAHRGNVAYDA
FT                   TKGGIEAMTRAMALDLAPYGVRVNGVVPGFINTYGLTDEQLRVREKTVPLGRYGVAEDM
FT                   TGAALFLASDDAVYITGQFISVDGGVLVQQRSANVDTFPVEGFPVVEADLL"
     MTNTASRRFD NRVVLVTGAA GGIGRAVAER FASEGARVAV NDIQVNAVRE VVGSITASGG        60
     SALAVPADVA DASQVDHMFT QIESTFGYVD VLYNNAGLID TARHFLEADE AWWDRIIQVN       120
     LKSVFLCSHR AARTMVRRRR GVIISTSSGG ATRAHRGNVA YDATKGGIEA MTRAMALDLA       180
     PYGVRVNGVV PGFINTYGLT DEQLRVREKT VPLGRYGVAE DMTGAALFLA SDDAVYITGQ       240
     FISVDGGVLV QQRSANVDTF PVEGFPVVEA DLL                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page