(data stored in ACNUC7421 zone)

EMBL: CP001115.PE43

CP001115.PE43        Location/Qualifiers
FT   CDS             66369..66605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00368"
FT                   /product="hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00368"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26543"
FT                   /db_xref="UniProtKB/TrEMBL:X5H5T4"
FT                   /protein_id="AHX26543.1"
FT                   /translation="MKHRQLAGLVLAASVALGSGAVAQNGNPRNMGTCSRAFAHVGLRP
FT                   LLNDFMRDIATLNRVLMGAVVLYLAHGGGNCRN"
     MKHRQLAGLV LAASVALGSG AVAQNGNPRN MGTCSRAFAH VGLRPLLNDF MRDIATLNRV        60
     LMGAVVLYLA HGGGNCRN                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page