(data stored in ACNUC7421 zone)

EMBL: CP001115.PE46

CP001115.PE46        Location/Qualifiers
FT   CDS             69089..69295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00385"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26544"
FT                   /db_xref="UniProtKB/TrEMBL:X5GY60"
FT                   /protein_id="AHX26544.1"
FT                   /translation="MSALDYSLTLWELESEHGENSTYYRMHQDIVEVTTWETLVKLWRA
FT                   VGFRIKTAYSWTASHLHIGQSHI"
     MSALDYSLTL WELESEHGEN STYYRMHQDI VEVTTWETLV KLWRAVGFRI KTAYSWTASH        60
     LHIGQSHI                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page