(data stored in ACNUC7421 zone)

EMBL: CP001115.PE47

CP001115.PE47        Location/Qualifiers
FT   CDS             69343..69765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00382"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00382"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47438"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1Z9"
FT                   /protein_id="ACO47438.1"
FT                   /translation="MEFSMTARDAPVTGVAVSSVLLTLKLLVTVRLLNGLVSTGAPNPD
FT                   QVTRVQLTRELRALSESSTMGAQAADHISTRLTAALSRADQDENARISPLGTPGKERDR
FT                   LHLTKTVPPKSGSQGGPNHAGREIRTATPPQDQATG"
     MEFSMTARDA PVTGVAVSSV LLTLKLLVTV RLLNGLVSTG APNPDQVTRV QLTRELRALS        60
     ESSTMGAQAA DHISTRLTAA LSRADQDENA RISPLGTPGK ERDRLHLTKT VPPKSGSQGG       120
     PNHAGREIRT ATPPQDQATG                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page