(data stored in ACNUC7421 zone)

EMBL: CP001115.PE54

CP001115.PE54        Location/Qualifiers
FT   CDS             79118..80317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00460"
FT                   /product="putative histidine kinase-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00460"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47445"
FT                   /db_xref="GOA:C1D206"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1D206"
FT                   /protein_id="ACO47445.2"
FT                   /translation="MPDHEHHIASEIQALQQQINTLEADLQACQHQGMTLFSEAPAPYV
FT                   LLNSQGRIQDVNRAATGLLGRHREVLLGRHFSQFLTPASQGSFELLLGQAVGHGLSRRG
FT                   EAQLNHADGSMFDVLLDLDAEHIDGEFQRFRLVITDITAYKQAHAGLLDNTAAQQEQLE
FT                   VHSARIRELNQELEQIVTVFIQQLHLPLTRALNFLGLTRRALGEVADEVNQPLLNTERA
FT                   VQQIIALMASIERFMQMRSMRVRLRSVDLNSVLREVRKHSRPLMADRNIDITSEPLPTV
FT                   QGDSRALYLILDEYISNALKFTKEKDPARIHVRVQESESEYHIGVEDNGAGFNMRQKDQ
FT                   LFRLFGRLHSSKVYEGSGVGLMTVRRACMRFGGRVWAEGKVNQGATFWFAWPKQPVIRD
FT                   "
     MPDHEHHIAS EIQALQQQIN TLEADLQACQ HQGMTLFSEA PAPYVLLNSQ GRIQDVNRAA        60
     TGLLGRHREV LLGRHFSQFL TPASQGSFEL LLGQAVGHGL SRRGEAQLNH ADGSMFDVLL       120
     DLDAEHIDGE FQRFRLVITD ITAYKQAHAG LLDNTAAQQE QLEVHSARIR ELNQELEQIV       180
     TVFIQQLHLP LTRALNFLGL TRRALGEVAD EVNQPLLNTE RAVQQIIALM ASIERFMQMR       240
     SMRVRLRSVD LNSVLREVRK HSRPLMADRN IDITSEPLPT VQGDSRALYL ILDEYISNAL       300
     KFTKEKDPAR IHVRVQESES EYHIGVEDNG AGFNMRQKDQ LFRLFGRLHS SKVYEGSGVG       360
     LMTVRRACMR FGGRVWAEGK VNQGATFWFA WPKQPVIRD                              399
//

If you have problems or comments...

PBIL Back to PBIL home page