(data stored in ACNUC7421 zone)

EMBL: CP001115.PE56

CP001115.PE56        Location/Qualifiers
FT   CDS             81987..82349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00471"
FT                   /product="putative DsrE/DsrF-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00471"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47447"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:C1D208"
FT                   /protein_id="ACO47447.1"
FT                   /translation="MAKLLVHVTCGPNDPTRAALAFLVARTAQEEGHPVTLFLAGDAVH
FT                   LLRPATLDALQGLGTGRLREHYDALRAGSAQFYLSGMSSAARGLAVSDLVQGSFELVKP
FT                   DVLVRLTFENDRVLSY"
     MAKLLVHVTC GPNDPTRAAL AFLVARTAQE EGHPVTLFLA GDAVHLLRPA TLDALQGLGT        60
     GRLREHYDAL RAGSAQFYLS GMSSAARGLA VSDLVQGSFE LVKPDVLVRL TFENDRVLSY       120
//

If you have problems or comments...

PBIL Back to PBIL home page