(data stored in ACNUC7421 zone)

EMBL: CP001115.PE58

CP001115.PE58        Location/Qualifiers
FT   CDS             83764..83973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00482"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26545"
FT                   /db_xref="UniProtKB/TrEMBL:X5H5M2"
FT                   /protein_id="AHX26545.1"
FT                   /translation="MDEHQVQPYVEALQERGCLVTQHPDGRYSVTLPDGETIEPGAPSV
FT                   HPQTPWSALIEACSRLNVTVPFGE"
     MDEHQVQPYV EALQERGCLV TQHPDGRYSV TLPDGETIEP GAPSVHPQTP WSALIEACSR        60
     LNVTVPFGE                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page